WDR21B Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The specific function of WDR21B is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR21B

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: HEEEGIVVAVGQDCYTRIWSLHDAHLLRTIPSPYSASEDDIPSVAFASRL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DDB1- and CUL4-associated factor 4-like protein 1

Protein Size: 396

Purification: Affinity Purified

• SKU: AVIARP54469_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54469_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 285429
• Host: Rabbit