WDR21B Antibody - middle region : HRP

WDR21B Antibody - middle region : HRP
SKU
AVIARP54469_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of WDR21B is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR21B

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: HEEEGIVVAVGQDCYTRIWSLHDAHLLRTIPSPYSASEDDIPSVAFASRL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DDB1- and CUL4-associated factor 4-like protein 1

Protein Size: 396

Purification: Affinity Purified
More Information
SKU AVIARP54469_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54469_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 285429
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×