Wnt8b Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Wnt8b is a ligand for members of the frizzled family of seven transmembrane receptors. It may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Wnt8b

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein Wnt-8b

Protein Size: 350

Purification: Affinity Purified

• SKU: AVIARP58100_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58100_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 22423
• Host: Rabbit