XAF1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: X-linked inhibitor of apoptosis (XIAP; MIM 300079) is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases (e.g., CASP3; M

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human XAF1

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: RSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTSSPRGDKAAYDIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: XIAP-associated factor 1

Protein Size: 301

Purification: Affinity Purified

• SKU: AVIARP56970_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56970_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54739
• Host: Rabbit