XAF1 Antibody - middle region : HRP

XAF1 Antibody - middle region : HRP
SKU
AVIARP56969_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: X-linked inhibitor of apoptosis (XIAP; MIM 300079) is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases (e.g., CASP3; M

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human XAF1

Key Reference: Bai,Y., (2008) J. Biol. Chem. 283 (11), 6832-6842

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: SRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: XIAP-associated factor 1

Protein Size: 301

Purification: Affinity Purified
More Information
SKU AVIARP56969_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56969_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54739
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×