XRCC2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: XRCC2 is a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human XRCC2

Key Reference: Yen,C.Y., (2008) J. Oral Pathol. Med. 37 (5), 271-277

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA repair protein XRCC2

Protein Size: 280

Purification: Affinity Purified

• SKU: AVIARP58558_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58558_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 7516
• Host: Rabbit
• Conjugate: Conjugated, FITC