AHA1 Protein

Yeast Recombinant AHA1 Protein
SKU
STRSPR-314A
Packaging Unit
50 µg
Manufacturer
Stressmarq Biosciences

Availability: loading...
Price is loading...
Target: AHA1 .

Nature: Recombinant.

Swiss-Prot: Q12449.

Expression System: E. coli.

Amino Acid Sequence: MGHHHHHHMVVNNPNNWHWVDKNCIGWAKEYFKQKLVGVEAGSVKDKKYAKIKSVSSIEGDCEVNQRKGKVISLFDLKITVLIEGHVDSKDGSALPFEGSINVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQFGKDLLATHGNDIQVPESQVKSNYTRGNQKSSFTEIKDSASKPKKNALPSSTSTSAPVSSTNKVPQNGSGNSTSIYLEPTFNVPSSELYETFLDKQRILAWTRSAQFFNSGPKLETKEKFELFGGNVISELVSCEKDKKLVFHWKLKDWSAPFNSTIEMTFHESQEFHETKLQVKWTGIPVGEEDRVRANFEEYYVRSIKLTFGFGAVL.

Purification: Affinity Purified.

Purity: >90%.

Storage Buffer: 12.5mM Hepes buffer pH7.2, 10mM NaCl, 50% glycerol.

Protein Size: ~405 kDa.

Conjugate: His tag.

Cellular Localization: Cytoplasm.

Scientific Background: Aha1 is a member of the HSP90 cochaperone family, and is thought to stimulate HSP90 ATPase activity by competing with p23 and other co-chaperones for HSP90 binding (1, 2). It may affect a step in the endoplasmic reticulum to Golgi trafficking. Aha1 also interacts with HSPCA/HSP90 and with the cytoplasmic tail of the vesicular stomatistis virus glycoproteins (VSV G) (3). Aha1 is expressed in numerous tissues, including the brain, heart, skeletal muscle, and kidney, and at low levels, the liver and placenta. Aha1 might be a potential therapeutic strategy to increase sensitivity to HSP inhibitors (4).

References: 1. Hainzl O., Lapina M.C., Buchner J., Richter K. (2009) J Biol Chem. Epub.2. Harst A., Lin H., Obermann W.M. (2005) Biochem J. 387 (pt.3): 789-796.3. Lotz G.P., Brychzy A., Heinz S., Obermann W.M. (2008) J Cell Sci. 121(pt.5): 717-723.4. Holmes J.L., Sharp S.Y., Hobbs S., Workman P. (2008) Cancer Res. 68(4): 1188-1197.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
More Information
SKU STRSPR-314A
Manufacturer Stressmarq Biosciences
Manufacturer SKU SPR-314A
Green Labware No
Package Unit 50 µg
Quantity Unit STK
Reactivity Yeast
Application Western Blotting, Functional Assay, SDS-PAGE
Human Gene ID 851800
Product information (PDF) Download
MSDS (PDF) Download