Ythdf1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Ythdf1

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: PAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQTGFHSDTLNK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Ythdf1 Ensembl ENSRNOP00000037700

Protein Size: 559

Purification: Affinity Purified

• SKU: AVIARP57031_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57031_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 296467
• Host: Rabbit