ZADH2 Antibody - N-terminal region : FITC

ZADH2 Antibody - N-terminal region : FITC
SKU
AVIARP55747_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZADH2

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: FVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc-binding alcohol dehydrogenase domain-containing protein 2

Protein Size: 377

Purification: Affinity Purified
More Information
SKU AVIARP55747_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55747_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 284273
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×