ZCCHC13 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZCCHC13

Key Reference: Lim,J., (2006) Cell 125 (4), 801-814

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger CCHC domain-containing protein 13

Protein Size: 166

Purification: Affinity Purified

• SKU: AVIARP55945_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55945_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 389874
• Host: Rabbit