ZHX3 Antibody - middle region : FITC

ZHX3 Antibody - middle region : FITC
SKU
AVIARP57983_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This protein is a member of the zinc fingers and homeoboxes (ZHX) gene family. The encoded protein contains two C2H2-type zinc fingers and five homeodomains and forms a dimer with itself or with zinc fingers and homeoboxes family member 1. In the nucleus, the dimerized protein interacts with the A subunit of the ubiquitous transcription factor nuclear factor-Y and may function as a transcriptional repressor.This gene encodes a member of the zinc fingers and homeoboxes (ZHX) gene family. The encoded protein contains two C2H2-type zinc fingers and five homeodomains and forms a dimer with itself or with zinc fingers and homeoboxes family member 1. In the nucleus, the dimerized protein interacts with the A subunit of the ubiquitous transcription factor nuclear factor-Y and may function as a transcriptional repressor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZHX3

Key Reference: Liu,G., (2006) J. Biol. Chem. 281 (51), 39681-39692

Molecular Weight: 105kDa

Peptide Sequence: Synthetic peptide located within the following region: ETKMTRREIDSWFSERRKKVNAEETKKAEENASQEEEEAAEDEGGEEDLA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc fingers and homeoboxes protein 3

Protein Size: 956

Purification: Affinity Purified
More Information
SKU AVIARP57983_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57983_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23051
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×