ZNF134 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: ZNF134 is a candidate transcription factor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF134

Key Reference: Tommerup,N. (1995) Genomics 27 (2), 259-264

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: TLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSECGKAFSRKDTLVQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 134

Protein Size: 427

Purification: Affinity Purified

• SKU: AVIARP58103_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58103_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 7693
• Host: Rabbit