ZNF257 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of ZNF257 has not yet been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF257

Key Reference: Han,Z.G., (1999) J. Biol. Chem. 274 (50), 35741-35748

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: PPVMCSHIAEDLCPERDIKYFFQKVILRRYDKCEHENLQLRKGCKSVDEC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 257

Protein Size: 563

Purification: Affinity Purified

• SKU: AVIARP57954_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57954_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 113835
• Host: Rabbit