Calculated MW: 81
Form: Liquid
Buffer (with preservative): PBS, 2% sucrose, 0.09% sodium azide.
Concentration: 1 mg/ml (Please refer to the vial label for the specific concentration.)
Background: This gene encodes a member of the SLC26A/SulP transporter family. The protein functions as a molecular motor in motile outer hair cells (OHCs) of the cochlea, inducing changes in cell length that act to amplify sound levels. The transmembrane protein is an incomplete anion transporter, and does not allow anions to cross the cell membrane but instead undergoes a conformational change in response to changes in intracellular Cl- levels that results in a change in cell length. The protein functions at microsecond rates, which is several orders of magnitude faster than conventional molecular motor proteins. Mutations in this gene are potential candidates for causing neurosensory deafness. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Nov 2009]
Uniprot ID: P58743
Antigen Species: Human
Immunogen: A synthetic peptide directed towards the middle region of human SLC26A5: FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS
Purification: Protein A purified
Conjugation: Unconjugated
Full Name: solute carrier family 26 member 5